close

Important Announcement
Title, thumbnail ya video me agar abusing, adult ya sexually explicit content paya gaya to channel bina kisi warning ke permanent delete kar diya jayega. Yeh rule turant lagu hai. Ab tak 350+ channels delete kiye ja chuke hain. Kripya kisi bhi prakar ka adult ya abusive content upload na karein. Rule violate hone par channel bina bataye delete ho jayega.


— Team ApnaTube

Top videos

Apna Tube
19,955 Views · 11 months ago

⁣ApnaTube Sharing Video Mobile Android Application (User Earn Money To Upload Video On ApnaTube App)

DINESHGAMER
17,633 Views · 5 months ago

apna tube monetization
apna tube channel monetization Puri jankari
APNA tube par channel monetization kese kare
apna tube par kitna subscribe par channel monetization hota hai
apna tube monetization
full gaidelin

Apna Tube
4,036 Views · 10 months ago

set your own configrtion

ankit jain
3,628 Views · 4 months ago

WATERPROOFING KE LIYE AAJ HI SAMPARK KRE

Apna Tube
2,980 Views · 11 months ago

⁣HostingUp ne launch kiye hain do zabardast naye services jo app developers aur creators ke liye game-changer sabit honge! 💥
🔹 ApnaTube.in – Apna khud ka YouTube jaisa platform banaiye aur content monetize kariye bina kisi restrictions ke!

🔹 Play Store Publishing Services – Ab apna Android app directly publish karaye Play Store pe bina kisi jhanjhat ke, HostingUp ke expert team ke saath!
Agar aap developer hain, ya apne bots, apps ya videos ko scale karna chahte hain, toh ye services aapke liye hi hain!

🛠 Naye Features at HostingUp:
✅ ApnaTube.in – YouTube Alternative with full control & monetization

✅ Play Store Publishing – Hassle-free app publishing

✅ Bot Hosting – 10 sec deployment with 24/7 uptime

✅ Console Panel – All-in-one dashboard: https://console.hostingup.in

📌 Join our Telegram for exclusive access & help:

🔗 Channel: https://t.me/AmRobots_Bots

🔗 Support Group: https://t.me/AmRobots_support
🖥 Start Now: https://hpanel.hostingup.in

📚 Related Videos:

• Hosting Telegram Bot in 10 Secs 👉 [Video Link]

• Host Mirror Leech Bot on HostingUp 👉 [Video Link]

• Configure Domain on HostingUp 👉 [Video Link]

🔥 LIKE ❤ | SUBSCRIBE 🔔 | SHARE 🧠

More tech tutorials, VPS hosting, bot guides & app deployment hacks coming soon!

#hostingup #apnatube #playstorepublishing #telegrambothosting #youtubealternative #botdeployment #androidapp #apppublishing #vpshosting #hostingupvps #techtutorial #onecommanddeploy #appmonetization #createandearn #telegrambots #indianhosting #hostyourapp #deployfast #techtools

Kedar Pooja Pravas
1,939 Views · 5 months ago

अमेरिकन युट्युब चा भारतीय पर्याय असलेल्या संपूर्ण स्वदेशी अपना ट्यूब तोंड ओळख करून घ्या मराठी मध्ये.
#स्वदेशी #DigitalIndia #ApnaTube #भारतीयएप #SwadeshiTech #DigitalAtmanirbharBharat #IndianApps #टेकलाइफ #डिजिटलक्रांति #IndianYouTubeAlternative #MadeInIndia #SelfReliantIndia #TechForIndia #VideosForIndia #AppIndia #YouTubeReplacement

नमस्ते 🙏
भारत के स्वदेशी तकनीक और डिजिटल आत्मनिर्भरता की शानदार यात्रा में आपका स्वागत है। इस वीडियो में देखिए भारत के मोबाइल एप्लिकेशन, जैसे "अपना ट्यूब" की विशेषताएं और फीचर्स जो यूट्यूब को टक्कर दे रहे हैं। जानिए कैसे ये ऐप्स हमारे स्वदेशी उद्योग को बढ़ावा दे रहे हैं और डिजिटल भारत के सपने को सच कर रहे हैं। अगर आप भारतीय ऐप्स से प्यार करते हैं और स्वदेशी तकनीक को सपोर्ट करना चाहते हैं, तो यह वीडियो आपके लिए है!

कृपया वीडियो को लाइक करें, शेयर करें और अपने दोस्तों के साथ इस स्वदेशी क्रांति को फैलाएं। सब्सक्राइब करना न भूलें! #स्वदेशी #digitalindia #apnatube #भारतीयएप #swadeshitech #digitalatmanirbharbharat #indianapps #टेकलाइफ #डिजिटलक्रांति #indianyoutubealternative #madeinindia #selfreliantindia #techforindia #videosforindia #appindia #youtubereplacement

Hemi Sharma
1,356 Views · 4 months ago

Mera short ApnaTube par trending gaya, (Hemi Sharma)
aur kisi ne bina permission ke download karke apne channel par daal diya.
Ye raha pura proof! ⚠
Creators ki respect karo — मेहनत chori mat karo.
#ApnaTube #ContentChori #TrendingIssue #CreatorRights #Shorts #RespectCreators #ApnaTubeTrending #Exposed #ViralShort #ProofVideo #OriginalContent #CreatorSupport
#VideoChor
#ApnaTubeAlert
#ContentCopy
#StolenVideo
#CopyPasteCreator
#OriginalVsCopy
#CreatorAwareness
#ApnaTubeUpdate
#ShortsAlert
#ProofOnScreen
#TrendingProof
#ViralIssue
#CreatorWarning
#CopyrightMatter
#CopiedContent
#RealityCheck
#ExposeMode
#AwarenessShort
#DontStealContent
#RespectTheCreator
#ApnaTubeShorts
#ShortsViral
#NewCreators
#TrendingNow #hemisharma

Hits Songs
1,141 Views · 5 months ago

Whenever you feel weak or losing hope_ just listen to Hanuman Chalisa – it has the power to bring strength_ courage_ and peace

4K Quality
⁣in this video you will find
⁣Apna Tube -
How to Register ?
How to Log in ?
How to Verify account ?
How to apply for Monotisation ?


Requremets of verification and monotisation
#apnatube #apna_tube
#अपना_ट्यूब
#kedar
#swadeshi
#indianapp

Apna Tube
1,064 Views · 11 months ago

⁣How To Setup Hostingup Vps Reseller And Configure

The3D Physics
992 Views · 4 months ago

⁣ DHURANDHAR Full Movie Download FREE! | Watch Online | New South/Bollywood Action Movie HD


🤯 DHURANDHAR Full Movie Download FREE! | Watch Online | New South/Bollywood Action Movie HD
About the Movie:
Watch the explosive action movie DHURANDHAR in HD! This is one of the most anticipated new releases of the year, featuring a stellar cast and non-stop thrilling moments. The movie runs for 2 hours and 35 minutes of pure entertainment.
🔥 How to Watch DHURANDHAR Full Movie FREE:
[Insert legitimate, authorized link to a platform where the movie is legally streaming/available. Note: I cannot provide links to illegal downloads. Always promote legal viewing options.]
Don't miss the powerful performance by the lead actors!
Like and Subscribe for more updates on new movie releases and full movie viewing guides!
#DHURANDHAR #FullMovie #FreeDownload #NewActionMovie #BollywoodMovies
dhuranhar full movie
dhuranhar movie download
dhuranhar full movie download
dhuranhar movie free
dhuranhar full movie online
new action movie
bollywood new movie 2025
latest hindi movie
south movie dubbed in hindi
dhuranhar ranveer singh (Assuming the lead resembles Ranveer Singh or if it's a popular search term)
full movie 2025
free movie download
jio studios movie
#DHURANDHAR
#DhurandharFullMovie
#NewMovie2025
#FreeMovieDownload
#ActionMovie
#BollywoodAction
#WatchDhurandhar
#HDMovie


❓ Queries :
dhuranhar full movie watch online free
dhuranhar movie download link
how to download dhuranhar full movie in hd
dhuranhar official trailer
dhuranhar movie cast
dhuranhar movie ending explained
new action movie 2025 hindi dubbed
jio studios dhuranhar full movie

Total 07
988 Views · 4 months ago

नंबर है Apna tube ग्रुप में जुड़ने के लिए जल्दी मैसेज करो ग्रुप फुल होने वाला है
ग्रुप लिंक

DINESHGAMER
953 Views · 5 months ago

APNA TUBE PAR TOP TRENDING JANE KI TRICK
APNA TUBE PAR VIDEO VIRAL KRO
APNA TUBE INDIA
ABHI TRENDING ME JAO
APNA TUBE PAR CHANNEL POPULAR KARNE KI PURI JANKARI

ApnatubeIndia
888 Views · 4 months ago

ApnaTube Channel Kaise Banaye & Monetize Kare 🤑| Complete Step-by-Step Guide 2025🔥

ApnaTube पर अपना चैनल बनाना चाहते हैं और उससे पैसे कमाना चाहते हैं?
इस वीडियो में मैं आपको Step-by-Step बताऊंगा कि ApnaTube Channel कैसे बनाते हैं,
वीडियो कैसे अपलोड करें, और Monetization कैसे Enable करें ताकि आप तुरंत earning शुरू कर सकें।

इस वीडियो में आप सीखेंगे:
✔ ApnaTube account kaise banaye
✔ Channel setup & branding
✔ SEO friendly title/description लिखना
✔ Monetization ON करने के तरीके
✔ Earnings बढ़ाने की Tips & Tricks

अगर आप भी अपना channel grow करना चाहते हैं तो इस वीडियो को पूरा जरूर देखें।

👍 Like
🔔 Subscribe - ApnatubeIndia ✅
💬 Comment ApnaTube अगर आप अगला tutorial चाहते हैं!

Your Queries -
ApnaTube channel kaise banaye
ApnaTube monetization kaise on kare
ApnaTube se paise kaise kamaye
ApnaTube earning trick
ApnaTube video upload kaise kare
YouTube alternative India
Video sharing platform se earning
ApnaTube tutorial Hindi
apnatube channel kaise banaye
apnatube monetization kaise on kare
apnatube se paise kaise kamaye
apnatube earning kaise hoti hai
apnatube video upload kaise kare
apnatube tutorial in hindi
apnatube earning proof
online earning platform 2025
video sharing platform earning
how to earn money from apnatube
apnatube channel setup guide
apnatube seo tips
apnatube views kaise badhaye
apnatube partner program
apnatube account kaise banaye
------------------------------------------
#ApnaTube
#Monetization
#YouTubeTips
#EarnMoneyOnline
#HindiTutorial
#VideoEarning
#ApnatubeIndia

Rohit
873 Views · 4 months ago

@#rohit

Technical Mehra
771 Views · 4 months ago

Aadhar Update 👍👍

*घर बैठे अपने आधार कार्ड में मोबाइल नंबर चेंज या अपडेट करने की प्रक्रिया जानने के लिए अब निम्न वीडियो की सहायता ले सकते हैं..…*

🔴 *On Indian Platform*
👉https://atoplay.com/video/02bc....e30c-e1e8-4b22-87df-

🔴 *On YouTube Platform*
👉https://youtu.be/hJdAqDZ2nLY

🛑 *For Healthy Lifestyle Please Like, Comments & Subscribe Our New Channel*
👉https://youtu.be/IkeWbPaHnJE

🌹🌹🌹🌹🌹🌹🌹🌹🌹
*On WhatsApp Channel*
👉https://whatsapp.com/channel/0....029Va9eynREKyZIbyujB

🌹🌹🌹🌹🌹🌹🌹🌹🌹
*On Telegram Channel*
👉https://t.me/Darpanhelpline

🌹🌹🌹🌹🌹🌹🌹🌹🌹
*On Twitter*
👉https://twitter.com/RAM_NIWAS_MEHRA?t=gCwqzl7Q_IgbH6Q4L1d-oA&s=09

*धन्यवाद*
🙏🏾🙏🏾🙏🏾🙏🏾🙏🏾🙏🏾🙏🏾🙏🏾
#Ifms3.0peraaygananaprapatrakaisebhare #ssoidseaayakargananaprapatrakaisebhare, #ifms3.0aayganananewprocess
#aaygananapraptrakaisebhare
#aaygananapraptranewprocess
#ifmsaaygananaprocess
#aaygananapraptraonlinekaisekare
#incometaxgananapraptrakaisebhare
#Ssoidincometax
#incometaxgananapraptraonlinekaisekare
#incometaxgananapraptraonlinekaisebhare
#incometaxgananapraptraonlineprocess
#incometaxnewregimeseaayakrgananapraptrakaisebhare
#ifms3_0peraaykargananapatrakaisebhare
#aayakargananaptraonlineprocess

in this video you will find
⁣Apna Tube -
How to Register ?
How to Log in ?
How to Verify account ?
How to apply for Monotisation ?

Requremets of verification and monotisation
#apnatube #Apna_Tube
#अपना_ट्यूब
#kedar
#swadeshi
#indianapp

Diego
714 Views · 10 months ago

Mariliendre Episodio 01




Showing 1 out of 2